PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC12G05280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 370aa    MW: 40736.1 Da    PI: 9.5057
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC12G05280.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1231.7e-072382711750
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                      A+rsR RK+++i+eLe++v++L++e  +   e++
  OPUNC12G05280.1 238 AQRSRVRKLQYIAELERRVQALQTEGVEVSAEMD 271
                      89*********************99776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-6227286IPR004827Basic-leucine zipper domain
CDDcd147032.86E-15228278No hitNo description
SuperFamilySSF579595.35E-6237280No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-6238292No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MMANSRFQKQ ALLPPRSPFP AAAAPSPSPS PHAELGPIAR PRDAPHRHGH QRTSSESVLI  60
DEQPSWLDDL LDEPEAPARP HGRPGHRRSS SDSFTLFDGG ASAAAASMYD NVFDGVRGRG  120
GGGQQVGSWG GAPEFFPEQS SFGRAQGQGG RPWDSILMLR QGGGGGMPVP MREMNGGHHG  180
PPNTFGDHGH GSLPNGVDRK GPGDSAHDQR IGAERKEGAH LRHSQSEADT KRAKQQYAQR  240
SRVRKLQYIA ELERRVQALQ TEGVEVSAEM DFLGQQNIML DLENKALKQR LESLSQEHLI  300
KRFQQEMFER EIGRLRSLFQ QQQQQQHIPQ QQAPTHSRSN SRDLDSQFAN MSLKHGDPNS  360
GRDAVPGLRI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2875550.0AK287555.1 Oryza sativa Japonica Group cDNA, clone: J065019F14, full insert sequence.
GenBankAK2877160.0AK287716.1 Oryza sativa Japonica Group cDNA, clone: J065134G21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618309.10.0PREDICTED: uncharacterized protein At4g06598
TrEMBLA0A0E0MKI40.0A0A0E0MKI4_ORYPU; Uncharacterized protein
STRINGORGLA12G0053300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.21e-53bZIP family protein